NP_080835.1 has 123 amino acids
Query: TXD17-like_Trx [M=119] Accession: PF06110.15 Description: Thioredoxin domain-containing protein 17-like, thioredoxin domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-57 176.2 0.1 1e-56 176.0 0.1 1.0 1 NP_080835.1 Domain annotation for each sequence (and alignments): >> NP_080835.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 176.0 0.1 1e-56 1e-56 2 119 .] 9 122 .. 8 122 .. 0.98 Alignments for each domain: == domain 1 score: 176.0 bits; conditional E-value: 1e-56 TXD17-like_Trx 2 vkgfeefekkvkelekesktvfilFsgekdteGesWCPdCvkaepvieealkeapedvklvvvdvGdrevWkdpanefRkdpklkltavPtLlrw 96 v+gfeef+k+vke +e kt+f++Fsg+kdteG+sWCPdCv+aepvi+e+lk+++ed+++++++vGd+++Wkdp+n+fR+ klk+tavPtLl++ NP_080835.1 9 VLGFEEFDKAVKE--HEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQ--KLKITAVPTLLKY 99 79**********9..8889*************************************************************..99*********** PP TXD17-like_Trx 97 kgkkrLeeeqllkssLvellfee 119 +++++L+e+++++ssLve++f+e NP_080835.1 100 GTPQKLVESECCQSSLVEMIFSE 122 *********************87 PP
Or compare NP_080835.1 to CDD or PaperBLAST