NP_001325459.1 has 279 amino acids
Query: SOK [M=89]
Accession: PF06136.17
Description: SOSEKI protein DIX-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-24 72.3 0.1 3.9e-24 71.1 0.1 1.7 1 NP_001325459.1
Domain annotation for each sequence (and alignments):
>> NP_001325459.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.1 0.1 3.9e-24 3.9e-24 46 89 .] 1 44 [. 1 44 [. 0.98
Alignments for each domain:
== domain 1 score: 71.1 bits; conditional E-value: 3.9e-24
SOK 46 maslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89
ma lyswsskr+yknGfvw+dl+++d+i+p++g+eyvlkgs++l
NP_001325459.1 1 MACLYSWSSKRTYKNGFVWYDLSDEDFIFPVHGQEYVLKGSQIL 44
999**************************************986 PP
Or compare NP_001325459.1 to CDD or PaperBLAST