PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10089799 to PF06136 (SOK)

VIMSS10089799 has 540 amino acids

Query:       SOK  [M=89]
Accession:   PF06136.17
Description: SOSEKI protein DIX-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    9.2e-55  169.3   0.1    1.6e-54  168.5   0.1    1.4  1  VIMSS10089799  


Domain annotation for each sequence (and alignments):
>> VIMSS10089799  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.5   0.1   1.6e-54   1.6e-54       1      89 []      34     122 ..      34     122 .. 0.99

  Alignments for each domain:
  == domain 1  score: 168.5 bits;  conditional E-value: 1.6e-54
            SOK   1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89 
                    v++vyyls+nrqlehphf+ev +ss++glylrdvierlnvlrG+gmas+yswsskrsy+nGfvwhdl+eddlilpa+g+eyvlkgsel+
  VIMSS10089799  34 VQIVYYLSKNRQLEHPHFMEVLISSPNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPANGNEYVLKGSELF 122
                    79*************************************************************************************85 PP



Or compare VIMSS10089799 to CDD or PaperBLAST