VIMSS10096816 has 343 amino acids
Query: SOK [M=89]
Accession: PF06136.17
Description: SOSEKI protein DIX-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-51 157.4 0.1 9.6e-51 156.4 0.1 1.6 1 VIMSS10096816
Domain annotation for each sequence (and alignments):
>> VIMSS10096816
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 156.4 0.1 9.6e-51 9.6e-51 1 89 [] 20 108 .. 20 108 .. 0.99
Alignments for each domain:
== domain 1 score: 156.4 bits; conditional E-value: 9.6e-51
SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89
v+vvyylsrn++l+hphf+ev+lss++glyl+dvi+rln lrG+gma lyswsskr+yknGfvw+dl+++d+i+p++g+eyvlkgs++l
VIMSS10096816 20 VPVVYYLSRNGRLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGNGMACLYSWSSKRTYKNGFVWYDLSDEDFIFPVHGQEYVLKGSQIL 108
79************************************************************************************985 PP
Or compare VIMSS10096816 to CDD or PaperBLAST