VIMSS10104953 has 414 amino acids
Query: SOK [M=89]
Accession: PF06136.17
Description: SOSEKI protein DIX-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-50 156.0 0.1 2.3e-50 155.2 0.1 1.4 1 VIMSS10104953
Domain annotation for each sequence (and alignments):
>> VIMSS10104953
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 155.2 0.1 2.3e-50 2.3e-50 1 88 [. 46 133 .. 46 134 .. 0.99
Alignments for each domain:
== domain 1 score: 155.2 bits; conditional E-value: 2.3e-50
SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsel 88
v+vvyyl+rn++lehphf+ev +++l+lrdv++rl++lrGk+m+s+y+ws+krsy+nGfvw+dlae+d+i+p++++eyvlkgse+
VIMSS10104953 46 VQVVYYLTRNGHLEHPHFIEVISPVNQPLRLRDVMNRLTILRGKCMTSQYAWSCKRSYRNGFVWNDLAENDVIYPSDCAEYVLKGSEI 133
79************************************************************************************98 PP
Or compare VIMSS10104953 to CDD or PaperBLAST