VIMSS10110567 has 423 amino acids
Query: SOK [M=89]
Accession: PF06136.17
Description: SOSEKI protein DIX-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-54 168.9 0.1 1.9e-54 168.2 0.1 1.3 1 VIMSS10110567
Domain annotation for each sequence (and alignments):
>> VIMSS10110567
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 168.2 0.1 1.9e-54 1.9e-54 1 89 [] 47 135 .. 47 135 .. 0.99
Alignments for each domain:
== domain 1 score: 168.2 bits; conditional E-value: 1.9e-54
SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89
v+vvyyl+rn+ql+hphf+ev+lss++glyl+dvi+rln lrGkgmaslyswsskrsyknGfvwhdl+edd+i+p++g+eyvlkgse+l
VIMSS10110567 47 VPVVYYLCRNGQLDHPHFIEVTLSSHDGLYLKDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL 135
79************************************************************************************986 PP
Or compare VIMSS10110567 to CDD or PaperBLAST