XP_008665220.1 has 562 amino acids
Query: SOK [M=89]
Accession: PF06136.17
Description: SOSEKI protein DIX-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-53 164.9 0.1 3.7e-53 164.1 0.1 1.4 1 XP_008665220.1
Domain annotation for each sequence (and alignments):
>> XP_008665220.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 164.1 0.1 3.7e-53 3.7e-53 1 89 [] 21 109 .. 21 109 .. 0.99
Alignments for each domain:
== domain 1 score: 164.1 bits; conditional E-value: 3.7e-53
SOK 1 vavvyylsrnrqlehphflevalsseeglylrdvierlnvlrGkgmaslyswsskrsyknGfvwhdlaeddlilpaegkeyvlkgsell 89
v+vvyyl+r+r+lehphf+ev+l+s+eglylrdvi++ln++rGkgma++ysws+krsyknGfvwhdl+eddl+lpa++ eyvlkgsel+
XP_008665220.1 21 VPVVYYLTRSRHLEHPHFVEVPLASPEGLYLRDVINHLNMVRGKGMAAMYSWSCKRSYKNGFVWHDLSEDDLVLPATDGEYVLKGSELV 109
79*************************************************************************************96 PP
Or compare XP_008665220.1 to CDD or PaperBLAST