O75936 has 387 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-20 59.2 0.8 4.1e-17 49.0 0.1 3.0 3 O75936 Domain annotation for each sequence (and alignments): >> O75936 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.0 0.1 4.1e-17 4.1e-17 8 84 .. 15 91 .. 9 92 .. 0.91 2 ! 16.6 0.1 5.4e-07 5.4e-07 6 42 .. 70 106 .. 66 115 .. 0.86 3 ? 0.8 0.0 0.046 0.046 52 79 .. 274 300 .. 238 304 .. 0.72 Alignments for each domain: == domain 1 score: 49.0 bits; conditional E-value: 4.1e-17 GBBH-like_N 8 rkLeiewddgktselpaewLRvacpcaecr..gpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyL 84 + ++i w d+++s +pa wLR++cpc+ c+ + + r+l + ++ ++ ik + ++++v i++ D+h s ++ ++L O75936 15 HLMQILWYDEEESLYPAVWLRDNCPCSDCYldSAKARKLLVEALDVNIGIKGLI-FDRKKVYITWPDEHYSE-FQADWL 91 689***************************95448888888888*********9.9***************9.***999 PP == domain 2 score: 16.6 bits; conditional E-value: 5.4e-07 GBBH-like_N 6 dsrkLeiewddgktselpaewLRvacpcaecrgpgqr 42 d++k+ i+w d++ se++a wL++ c + + r + qr O75936 70 DRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQR 106 67899***********************999955443 PP == domain 3 score: 0.8 bits; conditional E-value: 0.046 GBBH-like_N 52 dvkikeiepvgnyavrivfsDghdsgiY 79 + ki e++ g + vri+f++ + +i+ O75936 274 KHKIIELDDKG-QVVRINFNNATRDTIF 300 55666666666.6677777776666666 PP
Or compare O75936 to CDD or PaperBLAST