Q9QZU7 has 387 amino acids
Query: GBBH-like_N [M=85]
Accession: PF06155.16
Description: Gamma-butyrobetaine hydroxylase-like, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-21 61.7 0.3 1.7e-17 50.3 0.0 3.0 3 Q9QZU7
Domain annotation for each sequence (and alignments):
>> Q9QZU7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.3 0.0 1.7e-17 1.7e-17 7 84 .. 14 91 .. 9 92 .. 0.92
2 ! 17.3 0.0 3.1e-07 3.1e-07 6 37 .. 70 101 .. 66 115 .. 0.86
3 ? -0.1 0.0 0.084 0.084 2 75 .. 279 296 .. 239 305 .. 0.71
Alignments for each domain:
== domain 1 score: 50.3 bits; conditional E-value: 1.7e-17
GBBH-like_N 7 srkLeiewddgktselpaewLRvacpcaecr.gp.gqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyL 84
r ++i w dg++s +pa wLR++c+c+ c+ ++ + r+l + ++ ++++++++ ++++v i++ +gh s ++ ++L
Q9QZU7 14 ARLMQIFWHDGAESLYPAVWLRDNCQCSDCYlHSaKARKLLLEALDVNIRMDDLT-FDQKKVYITWPNGHYSE-FEANWL 91
6889***************************955688889999989999999999.9***************9.999998 PP
== domain 2 score: 17.3 bits; conditional E-value: 3.1e-07
GBBH-like_N 6 dsrkLeiewddgktselpaewLRvacpcaecr 37
d++k+ i+w +g+ se++a wL++ c + e r
Q9QZU7 70 DQKKVYITWPNGHYSEFEANWLKKRCFSQEAR 101
7899************************9998 PP
== domain 3 score: -0.1 bits; conditional E-value: 0.084
GBBH-like_N 2 rlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghd 75
+l+ ++++++i+ f++ +
Q9QZU7 279 ELDDKGQVVRIN--------------------------------------------------------FNNATR 296
344445555555........................................................554433 PP
Or compare Q9QZU7 to CDD or PaperBLAST