WP_003459003.1 has 123 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-31 94.6 0.0 3.3e-31 94.2 0.0 1.2 1 WP_003459003.1 Domain annotation for each sequence (and alignments): >> WP_003459003.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.2 0.0 3.3e-31 3.3e-31 1 85 [] 7 88 .. 7 88 .. 0.97 Alignments for each domain: == domain 1 score: 94.2 bits; conditional E-value: 3.3e-31 GBBH-like_N 1 irlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgiYsweyLr 85 i+l+k+s++Le+++ + ++++l+ae+LRv++p+ae++g+g+ +lqtgk +v +++iep+gnya+++ f+Dghdsg+Y+weyL+ WP_003459003.1 7 IKLHKASKTLELRYGE-QSYQLSAEFLRVHSPSAEVQGHGKPILQTGK--LNVGLERIEPAGNYALKLCFDDGHDSGLYTWEYLY 88 799***********76.789*****************99*********..**********************************7 PP
Or compare WP_003459003.1 to CDD or PaperBLAST