XP_034421548.1 has 651 amino acids
Query: GBBH-like_N [M=85] Accession: PF06155.16 Description: Gamma-butyrobetaine hydroxylase-like, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-13 35.7 1.8 2.1e-12 33.9 0.9 2.3 2 XP_034421548.1 Domain annotation for each sequence (and alignments): >> XP_034421548.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.0 0.074 0.074 50 84 .. 522 556 .. 504 557 .. 0.80 2 ! 33.9 0.9 2.1e-12 2.1e-12 21 84 .. 557 625 .. 538 626 .. 0.85 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.074 GBBH-like_N 50 eedvkikeiepvgnyavrivfsDghdsgiYsweyL 84 + +++ +i+ ++y ++++f+ ++ ++s ++L XP_034421548.1 522 NHTLNLPSIQIYNKYYIQLSFDSIQNKYVFSDDVL 556 5567778899999*********9999888876655 PP == domain 2 score: 33.9 bits; conditional E-value: 2.1e-12 GBBH-like_N 21 elpaewLRvacpcaecrgpgqrllqtgk......ieedvkikeiepvgnyavrivfsDghdsgiYsweyL 84 +++ + R +c c c++ +++ q++k ++ ++ +kei + g+y v++ +sD+h s iYs++yL XP_034421548.1 557 TCNSKDIRLKCACDICTNLKKNNPQKKKnikkyiFNHNIYVKEIIKLGAYNVKFIWSDNHVS-IYSYSYL 625 6788999**********545555555556777889**************************9.7*****9 PP
Or compare XP_034421548.1 to CDD or PaperBLAST