reanno::pseudo1_N1B4:Pf1N1B4_1554 has 125 amino acids
Query: GBBH-like_N [M=85]
Accession: PF06155.16
Description: Gamma-butyrobetaine hydroxylase-like, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-31 94.7 0.0 2.9e-31 94.4 0.0 1.1 1 reanno::pseudo1_N1B4:Pf1N1B4_1554
Domain annotation for each sequence (and alignments):
>> reanno::pseudo1_N1B4:Pf1N1B4_1554
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 94.4 0.0 2.9e-31 2.9e-31 1 85 [] 8 90 .. 8 90 .. 0.98
Alignments for each domain:
== domain 1 score: 94.4 bits; conditional E-value: 2.9e-31
GBBH-like_N 1 irlkkdsrkLeiewddgktselpaewLRvacpcaecrgpgqrllqtgkieedvkikeiepvgnyavrivfsDghdsgi 78
i+l+k+s++L+++++ g++++lpae+LRv++p+ae++g+g+ +lq gk v + ++ep+g+ya++++f+Dghdsg+
reanno::pseudo1_N1B4:Pf1N1B4_1554 8 IKLHKASKTLSLKYASGEEYHLPAEFLRVHSPSAEVQGHGKPILQFGK--IGVGLSKVEPAGQYALKLTFDDGHDSGL 83
799**********************************99*********..99************************** PP
GBBH-like_N 79 YsweyLr 85
++weyL+
reanno::pseudo1_N1B4:Pf1N1B4_1554 84 FTWEYLY 90
******7 PP
Or compare reanno::pseudo1_N1B4:Pf1N1B4_1554 to CDD or PaperBLAST