VIMSS306316 has 73 amino acids
Query: DUF987 [M=65]
Accession: PF06174.15
Description: Protein of unknown function (DUF987)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-44 135.6 0.0 2.4e-44 135.5 0.0 1.0 1 VIMSS306316
Domain annotation for each sequence (and alignments):
>> VIMSS306316
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 135.5 0.0 2.4e-44 2.4e-44 1 65 [] 1 65 [. 1 65 [. 0.99
Alignments for each domain:
== domain 1 score: 135.5 bits; conditional E-value: 2.4e-44
DUF987 1 mkiitkkeAveiarqhpasrlfkyctGKYkWhGsasdYtGrdvddipgvLAvyaERRkdaagpyv 65
mkiit++eA++i++qhpasrlf++ctGKY+WhGsa++YtGr+v+dipgvLAv+aERRkd++gpyv
VIMSS306316 1 MKIITRGEAMRIHQQHPASRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYV 65
9***************************************************************7 PP
Or compare VIMSS306316 to CDD or PaperBLAST