PaperBLAST – Find papers about a protein or its homologs

 

Align NP_150540.1 to PF06269 (DUF1029)

NP_150540.1 has 53 amino acids

Query:       DUF1029  [M=53]
Accession:   PF06269.16
Description: Protein of unknown function (DUF1029)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-29   88.4  12.2    1.4e-29   88.3  12.2    1.0  1  NP_150540.1  


Domain annotation for each sequence (and alignments):
>> NP_150540.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.3  12.2   1.4e-29   1.4e-29       1      53 []       1      53 []       1      53 [] 0.99

  Alignments for each domain:
  == domain 1  score: 88.3 bits;  conditional E-value: 1.4e-29
      DUF1029  1 MitnYePllLlgilcaallaNfvlsrktKldiiFvlqsilFlWfifHfvhsvi 53
                 MitnYePl+L gi+ ++ll N++ls k K++iiF++qsilF+WfifHfvhsv+
  NP_150540.1  1 MITNYEPLILFGIILITLLGNLKLSFKLKINIIFFIQSILFMWFIFHFVHSVF 53
                 9***************************************************8 PP



Or compare NP_150540.1 to CDD or PaperBLAST