VIMSS3213442 has 53 amino acids
Query: DUF1029 [M=53]
Accession: PF06269.16
Description: Protein of unknown function (DUF1029)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-32 98.0 11.0 1.4e-32 97.9 11.0 1.0 1 VIMSS3213442
Domain annotation for each sequence (and alignments):
>> VIMSS3213442
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 97.9 11.0 1.4e-32 1.4e-32 1 53 [] 1 53 [] 1 53 [] 0.99
Alignments for each domain:
== domain 1 score: 97.9 bits; conditional E-value: 1.4e-32
DUF1029 1 MitnYePllLlgilcaallaNfvlsrktKldiiFvlqsilFlWfifHfvhsvi 53
Mi+nYePllLl+i+c++ll+Nf++s+ktK+diiF++q+i+F+WfifHfvhs+i
VIMSS3213442 1 MISNYEPLLLLVITCCVLLFNFTISSKTKIDIIFAVQTIVFIWFIFHFVHSAI 53
9**************************************************86 PP
Or compare VIMSS3213442 to CDD or PaperBLAST