PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS348586 to PF06288 (DUF1040)

VIMSS348586 has 89 amino acids

Query:       DUF1040  [M=86]
Accession:   PF06288.17
Description: Protein of unknown function (DUF1040)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.4e-50  153.9   0.5    7.1e-50  153.7   0.5    1.0  1  VIMSS348586  


Domain annotation for each sequence (and alignments):
>> VIMSS348586  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.7   0.5   7.1e-50   7.1e-50       1      86 []       1      86 [.       1      86 [. 0.99

  Alignments for each domain:
  == domain 1  score: 153.7 bits;  conditional E-value: 7.1e-50
      DUF1040  1 mkckrinellellqpeWkkekdlnllqllqklaeeagfekeleeltddvliyhlkmresdkeemiPGlkkdveedfktallkarGi 86
                 mkckr+ne++ellqp+W+ke+dlnl+q+lqkla+e+gf+++le+ltdd+liyhlkmr+s k+++iPG++kd+eedfktall+arG+
  VIMSS348586  1 MKCKRLNEVIELLQPAWQKEPDLNLTQFLQKLAKESGFDGKLEDLTDDILIYHLKMRDSAKDAAIPGIQKDYEEDFKTALLRARGV 86
                 9************************************************************************************7 PP



Or compare VIMSS348586 to CDD or PaperBLAST