VIMSS146821 has 70 amino acids
Query: DUF1107 [M=63]
Accession: PF06526.16
Description: Protein of unknown function (DUF1107)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-32 98.1 0.7 1.2e-32 98.0 0.7 1.0 1 VIMSS146821
Domain annotation for each sequence (and alignments):
>> VIMSS146821
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.0 0.7 1.2e-32 1.2e-32 1 63 [] 1 63 [. 1 63 [. 0.98
Alignments for each domain:
== domain 1 score: 98.0 bits; conditional E-value: 1.2e-32
DUF1107 1 mriFkkYaPlqIAkyvktffkGrlyikglGrfeFdkGrlllpkkadkkvlkvvseiNeeikel 63
mriF++Y+P+++A yvkt+f+Grlyik++G+feFd+G++l+pk++dk++ +v+ e+N+++ +l
VIMSS146821 1 MRIFQRYNPAKVAMYVKTLFRGRLYIKDMGAFEFDNGKILVPKVKDKRHFEVMAEVNRQVLRL 63
9**********************************************************9886 PP
Or compare VIMSS146821 to CDD or PaperBLAST