P39390 has 54 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-18 52.1 8.5 2.8e-18 51.8 8.5 1.2 1 P39390
Domain annotation for each sequence (and alignments):
>> P39390
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 51.8 8.5 2.8e-18 2.8e-18 1 37 [] 18 54 .] 18 54 .] 0.97
Alignments for each domain:
== domain 1 score: 51.8 bits; conditional E-value: 2.8e-18
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
l++a+rrWrr +trr L+++sD+ L+DIGL+R+d++
P39390 18 LWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE 54
8**********************************86 PP
Or compare P39390 to CDD or PaperBLAST