VIMSS124220 has 47 amino acids
Query: DUF1127 [M=37] Accession: PF06568.15 Description: Domain of unknown function (DUF1127) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-21 59.7 0.1 1.1e-20 59.4 0.1 1.1 1 VIMSS124220 Domain annotation for each sequence (and alignments): >> VIMSS124220 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.4 0.1 1.1e-20 1.1e-20 1 37 [] 3 39 .. 3 39 .. 0.96 Alignments for each domain: == domain 1 score: 59.4 bits; conditional E-value: 1.1e-20 DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37 l++ +++Wr +R+t +eL+r+sDreL D+G+ R+di+ VIMSS124220 3 LARSFNNWRKYRQTCNELGRMSDRELTDLGIGRADIP 39 7899*******************************95 PP
Or compare VIMSS124220 to CDD or PaperBLAST