VIMSS340938 has 69 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-16 45.6 0.5 2.4e-16 45.6 0.5 1.4 2 VIMSS340938
Domain annotation for each sequence (and alignments):
>> VIMSS340938
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.2 0.1 0.41 0.41 12 18 .. 16 22 .. 15 22 .. 0.66
2 ! 45.6 0.5 2.4e-16 2.4e-16 2 37 .] 24 59 .. 23 59 .. 0.94
Alignments for each domain:
== domain 1 score: -3.2 bits; conditional E-value: 0.41
DUF1127 12 RrtrreL 18
R+t+ +L
VIMSS340938 16 RQTWLQL 22
7777666 PP
== domain 2 score: 45.6 bits; conditional E-value: 2.4e-16
DUF1127 2 raalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
+++l Wrr++rtrr+L +L++++++DIGL+ +ir
VIMSS340938 24 YSKLVVWRRNYRTRRHLKDLPEHLWDDIGLEANEIR 59
678999****************************97 PP
Or compare VIMSS340938 to CDD or PaperBLAST