VIMSS61893 has 67 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-15 40.7 6.3 8.3e-15 40.7 6.3 1.5 2 VIMSS61893
Domain annotation for each sequence (and alignments):
>> VIMSS61893
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.5 0.2 0.52 0.52 9 13 .. 14 18 .. 13 19 .. 0.53
2 ! 40.7 6.3 8.3e-15 8.3e-15 1 37 [] 22 58 .. 22 58 .. 0.95
Alignments for each domain:
== domain 1 score: -3.5 bits; conditional E-value: 0.52
DUF1127 9 rrrRr 13
r +Rr
VIMSS61893 14 RSNRR 18
45555 PP
== domain 2 score: 40.7 bits; conditional E-value: 8.3e-15
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
l+ +++ W+rr ++rr+LarL+ r+LaD G+s+++++
VIMSS61893 22 LLGTMKLWQRRIQSRRQLARLDSRLLADAGISEAQRY 58
6789******************************985 PP
Or compare VIMSS61893 to CDD or PaperBLAST