ecocyc::G7937-MONOMER has 54 amino acids
Query: DUF1127 [M=37] Accession: PF06568.15 Description: Domain of unknown function (DUF1127) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-18 52.1 8.5 2.8e-18 51.8 8.5 1.2 1 ecocyc::G7937-MONOMER Domain annotation for each sequence (and alignments): >> ecocyc::G7937-MONOMER # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.8 8.5 2.8e-18 2.8e-18 1 37 [] 18 54 .] 18 54 .] 0.97 Alignments for each domain: == domain 1 score: 51.8 bits; conditional E-value: 2.8e-18 DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37 l++a+rrWrr +trr L+++sD+ L+DIGL+R+d++ ecocyc::G7937-MONOMER 18 LWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE 54 8**********************************86 PP
Or compare ecocyc::G7937-MONOMER to CDD or PaperBLAST