VIMSS147099 has 90 amino acids
Query: DUF1145 [M=58] Accession: PF06611.16 Description: Protein of unknown function (DUF1145) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-31 91.8 8.0 1.4e-30 91.3 8.0 1.3 1 VIMSS147099 Domain annotation for each sequence (and alignments): >> VIMSS147099 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.3 8.0 1.4e-30 1.4e-30 1 58 [] 1 58 [. 1 58 [. 0.98 Alignments for each domain: == domain 1 score: 91.3 bits; conditional E-value: 1.4e-30 DUF1145 1 mlinlGkllmlvvWlvllvNliqPfpgplnillniagivlvlmHllqlllfkaalkkk 58 m+inlG+llml+vW+++l+Nl+qP+p+pl +++++a+i++vlmH+lql+l+k++++k+ VIMSS147099 1 MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMHGLQLVLLKSTQPKD 58 89*****************************************************996 PP
Or compare VIMSS147099 to CDD or PaperBLAST