SwissProt::M0R3K6 has 131 amino acids
Query: DUF1151 [M=111]
Accession: PF06625.14
Description: Protein of unknown function (DUF1151)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-43 132.4 18.5 4e-43 132.2 18.5 1.0 1 SwissProt::M0R3K6
Domain annotation for each sequence (and alignments):
>> SwissProt::M0R3K6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 132.2 18.5 4e-43 4e-43 2 111 .] 14 120 .. 13 120 .. 0.96
Alignments for each domain:
== domain 1 score: 132.2 bits; conditional E-value: 4e-43
DUF1151 2 elikPkKllnpvlasksrqeLhrELllnqkrklvleeKpELqrvlekrkeeqvlkqkkeeeeakkkkseLeqelekraqrleelekeeekak 93
elikPkKllnpv+as+s+qeLhrELl+n+kr+l +++KpELqrvle+r+++q++k+k+ee eak++++++eqel++r+qrl++le+ ++
SwissProt::M0R3K6 14 ELIKPKKLLNPVKASRSHQELHRELLMNHKRGLGMDRKPELQRVLEHRRRNQLIKKKEEELEAKRMQCPFEQELLRRQQRLNQLENPPQR-- 103
8*********************************************************************************99988877.. PP
DUF1151 94 eeqekapefvkvkekLrr 111
e+++apef+kv+e+Lrr
SwissProt::M0R3K6 104 -EEDHAPEFIKVRENLRR 120
.4568***********97 PP
Or compare SwissProt::M0R3K6 to CDD or PaperBLAST