XP_038949391.1 has 172 amino acids
Query: DUF1151 [M=111]
Accession: PF06625.14
Description: Protein of unknown function (DUF1151)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.1e-43 131.6 18.5 9.7e-43 131.0 18.5 1.3 1 XP_038949391.1
Domain annotation for each sequence (and alignments):
>> XP_038949391.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 131.0 18.5 9.7e-43 9.7e-43 2 111 .] 55 161 .. 54 161 .. 0.96
Alignments for each domain:
== domain 1 score: 131.0 bits; conditional E-value: 9.7e-43
DUF1151 2 elikPkKllnpvlasksrqeLhrELllnqkrklvleeKpELqrvlekrkeeqvlkqkkeeeeakkkkseLeqelekraqrleelekeeekakeeq 96
elikPkKllnpv+as+s+qeLhrELl+n+kr+l +++KpELqrvle+r+++q++k+k+ee eak++++++eqel++r+qrl++le+ ++ e+
XP_038949391.1 55 ELIKPKKLLNPVKASRSHQELHRELLMNHKRGLGMDRKPELQRVLEHRRRNQLIKKKEEELEAKRMQCPFEQELLRRQQRLNQLENPPQR---EE 146
8*********************************************************************************99988877...45 PP
DUF1151 97 ekapefvkvkekLrr 111
++apef+kv+e+Lrr
XP_038949391.1 147 DHAPEFIKVRENLRR 161
68***********97 PP
Or compare XP_038949391.1 to CDD or PaperBLAST