REBASE::M.Bbr8344I has 731 amino acids
Query: DUF1156 [M=73]
Accession: PF06634.16
Description: Protein of unknown function (DUF1156)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-12 33.3 2.0 6.6e-12 31.7 2.0 1.8 1 REBASE::M.Bbr8344I
Domain annotation for each sequence (and alignments):
>> REBASE::M.Bbr8344I
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 31.7 2.0 6.6e-12 6.6e-12 14 46 .. 51 82 .. 43 95 .. 0.83
Alignments for each domain:
== domain 1 score: 31.7 bits; conditional E-value: 6.6e-12
DUF1156 14 EksirhgqhlstLhlwWaRrPLaavRAvilaqL 46
E+ + g+++ t+h+wWaRrP a+RA ++a+L
REBASE::M.Bbr8344I 51 ER-YGRGETPHTIHVWWARRPHSAMRALVYAAL 82
44.45588***********************98 PP
Or compare REBASE::M.Bbr8344I to CDD or PaperBLAST