VIMSS146011 has 149 amino acids
Query: DUF1198 [M=143] Accession: PF06711.15 Description: Protein of unknown function (DUF1198) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-75 238.0 0.5 1.8e-75 237.9 0.5 1.0 1 VIMSS146011 Domain annotation for each sequence (and alignments): >> VIMSS146011 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 237.9 0.5 1.8e-75 1.8e-75 1 143 [] 1 143 [. 1 143 [. 1.00 Alignments for each domain: == domain 1 score: 237.9 bits; conditional E-value: 1.8e-75 DUF1198 1 miwlilatlvvvfvvGfrvltsdtrrairrlserlkiepvviesmidqlGktaggeflrylerpneeelqnaaqvlliyqvvivdasdenlelwrrll 98 m+w+i+a+l+vvf+vG+rvltsdtr+ai+++s++lki+p++iesm++++G++++++f+r+++++++ee+++aa++++iy+++i+++sden+elwr++l VIMSS146011 1 MTWIIIAVLIVVFIVGYRVLTSDTRKAIDTISNLLKIKPIYIESMLQEMGPRQTQMFIRSTSNGSAEEVRKAAYLVFIYHTFIKNPSDENVELWRNTL 98 9************************************************************************************************* PP DUF1198 99 qkarlaapladeqirlalgflreldpdlselkafqrrynalfnPe 143 ++a+++++la+e++++al++++eld+d++el++f+r+yn +fnPe VIMSS146011 99 IRAQISPILAAEHTDAALFYFAELDLDAFELAQFRRHYNLHFNPE 143 ********************************************8 PP
Or compare VIMSS146011 to CDD or PaperBLAST