A4F7P3 has 421 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-69 217.2 0.8 7.1e-69 216.5 0.8 1.4 1 A4F7P3 Domain annotation for each sequence (and alignments): >> A4F7P3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.5 0.8 7.1e-69 7.1e-69 2 145 .] 270 413 .. 269 413 .. 0.99 Alignments for each domain: == domain 1 score: 216.5 bits; conditional E-value: 7.1e-69 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 ++l++v+++DaEi++++d+++ ++++++pdnvR+v+fvP+++llptcaa+vHhgG+gs++ta+++GvPqv+lpd++d+ vra+r++e+Gagi+l+ A4F7P3 270 ELLGAVGDVDAEIIATFDAQQLEGVANIPDNVRTVGFVPMHALLPTCAATVHHGGPGSWHTAAIHGVPQVILPDGWDTGVRAQRTQEFGAGIALP 364 799******************************************************************************************** PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 ++elt+d+++++v++v++dpa+ra+aa+++++++aePsP+Ev+ +eel A4F7P3 365 VPELTPDQLRESVKRVLDDPAHRAGAARMRDDMLAEPSPAEVVGICEEL 413 **********************************************997 PP
Or compare A4F7P3 to CDD or PaperBLAST