NP_013290.1 has 1198 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-18 52.4 0.0 5.3e-18 51.5 0.0 1.3 1 NP_013290.1 Domain annotation for each sequence (and alignments): >> NP_013290.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.5 0.0 5.3e-18 5.3e-18 25 128 .. 1040 1141 .. 1031 1147 .. 0.88 Alignments for each domain: == domain 1 score: 51.5 bits; conditional E-value: 5.3e-18 EryCIII-like_C 25 dlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpa 117 +lp n+ ++ vP + l p+ +a vHhgG+g+t ++l +G+P v+ p + d++ a rv ++G gi+l+k l+++++a+a++ + ++ NP_013290.1 1040 TEVDLPRNILNIGNVPHDWLFPQVDAAVHHGGSGTTGASLRAGLPTVIKPFFGDQFFYAGRVEDIGVGIALKK--LNAQTLADALKVATTNKI 1130 44579******************************************************************86..678889999988888888 PP EryCIII-like_C 118 yraaaaklaee 128 ++ a+ +++ NP_013290.1 1131 MKDRAGLIKKK 1141 88887766655 PP
Or compare NP_013290.1 to CDD or PaperBLAST