SwissProt::Q2U0C3 has 1384 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.8e-13 34.7 0.0 1.7e-12 33.6 0.0 1.5 1 SwissProt::Q2U0C3
Domain annotation for each sequence (and alignments):
>> SwissProt::Q2U0C3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 33.6 0.0 1.7e-12 1.7e-12 29 98 .. 1194 1263 .. 1185 1295 .. 0.89
Alignments for each domain:
== domain 1 score: 33.6 bits; conditional E-value: 1.7e-12
EryCIII-like_C 29 lpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskd 98
lp+++ ++ P + l + +a HhgGag+t ++l +GvP +v p + d++ + rv +lG gi+++k
SwissProt::Q2U0C3 1194 LPPEIFQIQAAPHDWLFSQIDAAAHHGGAGTTGASLRAGVPTIVKPFFGDQFFFGTRVEDLGVGICMKKL 1263
5677777888899999*************************************************99875 PP
Or compare SwissProt::Q2U0C3 to CDD or PaperBLAST