SwissProt::Q9AFC7 has 408 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-18 51.8 0.6 9.1e-18 50.7 0.6 1.5 1 SwissProt::Q9AFC7
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9AFC7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.7 0.6 9.1e-18 9.1e-18 36 126 .. 291 380 .. 281 391 .. 0.89
Alignments for each domain:
== domain 1 score: 50.7 bits; conditional E-value: 9.1e-18
EryCIII-like_C 36 vdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaakla 126
+d v +++l aa++Hhg ag+ + a +GvPq+v+p + d++ a rva+lG g++ ++ t +s+ +a++ v++ + ra a+ +a
SwissProt::Q9AFC7 291 IDEVNFQALFRRVAAVIHHGSAGTEHVATRAGVPQLVIPRNTDQPYFAGRVAALGIGVAHDGPTPTFESLSAALTTVLAPE-TRARAEAVA 380
5778889999******************************************************************99854.456555555 PP
Or compare SwissProt::Q9AFC7 to CDD or PaperBLAST