SwissProt::Q9Y751 has 1211 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-18 52.3 0.0 6.8e-18 51.1 0.0 1.5 1 SwissProt::Q9Y751
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9Y751
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 51.1 0.0 6.8e-18 6.8e-18 28 131 .. 1062 1163 .. 1032 1167 .. 0.93
Alignments for each domain:
== domain 1 score: 51.1 bits; conditional E-value: 6.8e-18
EryCIII-like_C 28 elpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpa 117
elp+++ + vP + l +a vHhgG+g+t ++l +G+P ++ p + d++ a+rv ++G gi l+k l+s+s+ ka++ev+ +
SwissProt::Q9Y751 1062 ELPEEIYNSGNVPHDWLFGKIDASVHHGGSGTTGATLRAGIPTIIKPFFGDQFFYANRVEDIGVGIGLRK--LNSKSLSKAIKEVTTNTR 1149
789999999*********************************************************9986..88999************9 PP
EryCIII-like_C 118 yraaaaklaeeiaa 131
+ a+++ ++i +
SwissProt::Q9Y751 1150 IIEKAKEIGKQIQS 1163
99999999887765 PP
Or compare SwissProt::Q9Y751 to CDD or PaperBLAST