WP_006498733.1 has 427 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.2e-24 70.3 1.8 1.5e-23 69.5 1.4 1.6 2 WP_006498733.1
Domain annotation for each sequence (and alignments):
>> WP_006498733.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.1 0.0 0.18 0.18 73 99 .. 262 289 .. 252 298 .. 0.67
2 ! 69.5 1.4 1.5e-23 1.5e-23 33 134 .. 299 397 .. 269 407 .. 0.91
Alignments for each domain:
== domain 1 score: -2.1 bits; conditional E-value: 0.18
EryCIII-like_C 73 lpdeadaavrarrvaelGa.givlskde 99
+ + a a + a ++ ++Ga gi l++++
WP_006498733.1 262 VDHAAYARAVADALRATGArGILLTPHD 289
4455556666666777777566666655 PP
== domain 2 score: 69.5 bits; conditional E-value: 1.5e-23
EryCIII-like_C 33 vRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaaklae 127
vR fvP+ llp c a+vHhgG g+ + a +G+ qvv p d++ +a+rv++ G+g+ + l+ +++ +a+a+v+++pa+ a++ ++
WP_006498733.1 299 VR--RFVPMRTLLPRCRALVHHGGIGTAALACEAGIVQVVTPFAHDQFDNAQRVVANGCGVRVDG-PLDGARLGAALARVLDEPAFAVHAERTRA 390
45..7********************************************************9875.58999***********************9 PP
EryCIII-like_C 128 eiaaePs 134
aa P
WP_006498733.1 391 LLAAAPD 397
9999996 PP
Or compare WP_006498733.1 to CDD or PaperBLAST