VIMSS1787552 has 172 amino acids
Query: TMEM175 [M=88] Accession: PF06736.15 Description: Endosomal/lysosomal potassium channel TMEM175 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-20 59.8 4.0 1.9e-19 56.2 0.6 2.3 2 VIMSS1787552 Domain annotation for each sequence (and alignments): >> VIMSS1787552 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.2 0.6 1.9e-19 1.9e-19 21 88 .] 14 78 .. 9 78 .. 0.94 2 ! 4.7 0.2 0.0024 0.0024 35 65 .. 88 118 .. 83 145 .. 0.67 Alignments for each domain: == domain 1 score: 56.2 bits; conditional E-value: 1.9e-19 TMEM175 21 lkvpekeeeellaallellpellayllsFlvvaifWinhhrlfrlikkvdkrllwlnlllllfisllP 88 +k+p+ ++ + al el+ llay+lsF++++++W+nhh+l r ik+++ r+++ln+l+l+++s++P VIMSS1787552 14 FKTPD---KSGWPALTELTVPLLAYALSFFMIMTVWYNHHQLYRDIKNITPRIFLLNTLCLFIMSFFP 78 56676...899********************************************************9 PP == domain 2 score: 4.7 bits; conditional E-value: 0.0024 TMEM175 35 llellpellayllsFlvvaifWinhhrlfrl 65 e+lpe++ ++ Fl+ a+f + +l++ VIMSS1787552 88 ATEFLPEFFYLVIVFLWTAVFHLMDYELLKE 118 5578899999999999999998888877754 PP
Or compare VIMSS1787552 to CDD or PaperBLAST