NP_998098.1 has 210 amino acids
Query: PDC10_C [M=90] Accession: PF06840.15 Description: Programmed cell death protein 10, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-44 134.8 2.2 8.8e-44 133.8 2.2 1.5 1 NP_998098.1 Domain annotation for each sequence (and alignments): >> NP_998098.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 133.8 2.2 8.8e-44 8.8e-44 1 90 [] 72 159 .. 72 159 .. 0.98 Alignments for each domain: == domain 1 score: 133.8 bits; conditional E-value: 8.8e-44 PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 +n++eslLr+a++ dveey i+r e+efq+ln+karaLk+iLs+iPdeindR +fL+tik+iAsaik+lLd+vn+v++k+q+ ++++ale NP_998098.1 72 INFTESLLRMAAD-DVEEYLIKRPEQEFQDLNEKARALKHILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFRKYQY-QNRRALE 159 89***********.********************************************************************.8899997 PP
Or compare NP_998098.1 to CDD or PaperBLAST