C1LI02 has 72 amino acids
Query: DUF1242 [M=35] Accession: PF06842.16 Description: Protein of unknown function (DUF1242) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-23 67.9 2.2 4.1e-23 67.4 2.2 1.3 1 C1LI02 Domain annotation for each sequence (and alignments): >> C1LI02 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.4 2.2 4.1e-23 4.1e-23 1 35 [] 10 44 .. 10 44 .. 0.99 Alignments for each domain: == domain 1 score: 67.4 bits; conditional E-value: 4.1e-23 DUF1242 1 LLvViLLlICTCTYvrqlfPslldrnktgflGifW 35 LL+ViLLlICTC+Y+r++ P+lld++k+g+lG+fW C1LI02 10 LLSVILLLICTCAYIRHFSPALLDSRKHGLLGLFW 44 8********************************** PP
Or compare C1LI02 to CDD or PaperBLAST