PaperBLAST – Find papers about a protein or its homologs

 

Align C1LI02 to PF06842 (DUF1242)

C1LI02 has 72 amino acids

Query:       DUF1242  [M=35]
Accession:   PF06842.16
Description: Protein of unknown function (DUF1242)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.8e-23   67.9   2.2    4.1e-23   67.4   2.2    1.3  1  C1LI02    


Domain annotation for each sequence (and alignments):
>> C1LI02  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.4   2.2   4.1e-23   4.1e-23       1      35 []      10      44 ..      10      44 .. 0.99

  Alignments for each domain:
  == domain 1  score: 67.4 bits;  conditional E-value: 4.1e-23
  DUF1242  1 LLvViLLlICTCTYvrqlfPslldrnktgflGifW 35
             LL+ViLLlICTC+Y+r++ P+lld++k+g+lG+fW
   C1LI02 10 LLSVILLLICTCAYIRHFSPALLDSRKHGLLGLFW 44
             8********************************** PP



Or compare C1LI02 to CDD or PaperBLAST