NP_079611.2 has 72 amino acids
Query: DUF1242 [M=35]
Accession: PF06842.16
Description: Protein of unknown function (DUF1242)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-25 74.1 2.7 5.1e-25 73.5 2.7 1.3 1 NP_079611.2
Domain annotation for each sequence (and alignments):
>> NP_079611.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.5 2.7 5.1e-25 5.1e-25 1 35 [] 10 44 .. 10 44 .. 0.99
Alignments for each domain:
== domain 1 score: 73.5 bits; conditional E-value: 5.1e-25
DUF1242 1 LLvViLLlICTCTYvrqlfPslldrnktgflGifW 35
LL+ViLLlICTC+Y+r+l+Ps+ldrnktg+lGifW
NP_079611.2 10 LLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFW 44
8********************************** PP
Or compare NP_079611.2 to CDD or PaperBLAST