Q5ZII6 has 72 amino acids
Query: DUF1242 [M=35]
Accession: PF06842.16
Description: Protein of unknown function (DUF1242)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-24 72.1 3.0 2e-24 71.6 3.0 1.3 1 Q5ZII6
Domain annotation for each sequence (and alignments):
>> Q5ZII6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.6 3.0 2e-24 2e-24 1 35 [] 10 44 .. 10 44 .. 0.99
Alignments for each domain:
== domain 1 score: 71.6 bits; conditional E-value: 2e-24
DUF1242 1 LLvViLLlICTCTYvrqlfPslldrnktgflGifW 35
LL+ViLLlICTC+Y+r+l+Pslld+nktg+lGifW
Q5ZII6 10 LLTVILLLICTCAYIRSLAPSLLDKNKTGLLGIFW 44
8********************************** PP
Or compare Q5ZII6 to CDD or PaperBLAST