SwissProt::G2TRS3 has 73 amino acids
Query: DUF1242 [M=35]
Accession: PF06842.16
Description: Protein of unknown function (DUF1242)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-21 61.9 1.9 3.1e-21 61.4 1.9 1.2 1 SwissProt::G2TRS3
Domain annotation for each sequence (and alignments):
>> SwissProt::G2TRS3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.4 1.9 3.1e-21 3.1e-21 1 35 [] 10 44 .. 10 44 .. 0.99
Alignments for each domain:
== domain 1 score: 61.4 bits; conditional E-value: 3.1e-21
DUF1242 1 LLvViLLlICTCTYvrqlfPslldrnktgflGifW 35
LL ViLL+ICTCTY++++fP+ll+++k+g+ +fW
SwissProt::G2TRS3 10 LLFVILLTICTCTYLHRQFPALLEKRKEGVTMVFW 44
89********************************* PP
Or compare SwissProt::G2TRS3 to CDD or PaperBLAST