SwissProt::Q9VWH8 has 72 amino acids
Query: DUF1242 [M=35]
Accession: PF06842.16
Description: Protein of unknown function (DUF1242)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-25 74.9 2.5 3e-25 74.2 2.5 1.4 1 SwissProt::Q9VWH8
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9VWH8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.2 2.5 3e-25 3e-25 1 35 [] 10 44 .. 10 44 .. 0.99
Alignments for each domain:
== domain 1 score: 74.2 bits; conditional E-value: 3e-25
DUF1242 1 LLvViLLlICTCTYvrqlfPslldrnktgflGifW 35
LL+ViLLlICTC+Y+r+lfPsl+drnktgf+G+fW
SwissProt::Q9VWH8 10 LLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFW 44
8********************************** PP
Or compare SwissProt::Q9VWH8 to CDD or PaperBLAST