VIMSS5782672 has 317 amino acids
Query: DUF1266 [M=175] Accession: PF06889.15 Description: Protein of unknown function (DUF1266) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-23 69.7 10.0 2.6e-23 69.2 10.0 1.2 1 VIMSS5782672 Domain annotation for each sequence (and alignments): >> VIMSS5782672 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.2 10.0 2.6e-23 2.6e-23 2 167 .. 95 261 .. 94 271 .. 0.77 Alignments for each domain: == domain 1 score: 69.2 bits; conditional E-value: 2.6e-23 DUF1266 2 LeesWgitdresaletlewLleeghrkefdevlerlralseeelreelae.leedekelarakgaleekveryyerlgeegil..AWDlgRavnlar 95 L+ +Wg++dr +++ +l wLl++gh ++f ++++++ + +ee ++ + l d +e +++++ ++ + +r++ + ++ WDl+R ++l+ VIMSS5782672 95 LSAAWGVNDRWDLIYQLFWLLTQGHTNDFYQLRDQILNGKEEDIQSLKNDiLLSDLTENDKNERLWQ-IDMMNTNRMNIQNVKylIWDLCRFNKLCL 190 8899*******************************99977766655443312233333333333444.33444555555554455************ PP DUF1266 96 wgyqagylseeeawelllkaarkaqraYssWeefaasyllGrlfwqgededdaaseykemlealeeLlsdpd 167 g+q gy++++ea+++ l a++++r Y+ We++ +++++ r +w++ d++ a+s +++ + ++ l++++ VIMSS5782672 191 EGCQQGYITQQEAQTWSLMSASMLRRIYDGWEDMWQNFIATRWLWASGDQNWASSH-QTFSDVVQNILKAEN 261 ************************************************99875555.666666666555554 PP
Or compare VIMSS5782672 to CDD or PaperBLAST