CharProtDB::CH_123413 has 212 amino acids
Query: FAM210A-B_dom [M=88]
Accession: PF06916.17
Description: FAM210A/B-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.7e-31 92.6 0.1 1.5e-30 91.8 0.1 1.4 1 CharProtDB::CH_123413
Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_123413
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.8 0.1 1.5e-30 1.5e-30 1 87 [. 33 156 .. 33 157 .. 0.98
Alignments for each domain:
== domain 1 score: 91.8 bits; conditional E-value: 1.5e-30
FAM210A-B_dom 1 qklKelfkkYGkvalgvylsislislgifYllvks.gvd.vealleklgls...................................ek 51
q +K+l+k+YG+ al+vyl++s+i+l+i+Y+lv+s g + +e +++k++++ +
CharProtDB::CH_123413 33 QGIKALMKEYGYPALAVYLGLSCIDLPICYVLVHSmGQEkIEVYENKVKQTfgygisdeelkkkqeinkiqqdiesqgettsensgSM 120
679*********************************9999********************************************9999 PP
FAM210A-B_dom 52 kvekksksswgelaiAYaihKilapiRlpiTlaltp 87
++ +s+ sw+e+aiAY ihK+l++iRlpiT+a+tp
CharProtDB::CH_123413 121 VSYILSQFSWTEFAIAYGIHKSLIFIRLPITAAITP 156
99999******************************9 PP
Or compare CharProtDB::CH_123413 to CDD or PaperBLAST