Q5XIJ4 has 273 amino acids
Query: FAM210A-B_dom [M=88] Accession: PF06916.17 Description: FAM210A/B-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-32 97.7 0.2 3.9e-32 96.9 0.2 1.4 1 Q5XIJ4 Domain annotation for each sequence (and alignments): >> Q5XIJ4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.9 0.2 3.9e-32 3.9e-32 1 87 [. 125 211 .. 125 212 .. 0.98 Alignments for each domain: == domain 1 score: 96.9 bits; conditional E-value: 3.9e-32 FAM210A-B_dom 1 qklKelfkkYGkvalgvylsislislgifYllvksgvdvealleklglsekkvekksksswgelaiAYaihKilapiRlpiTlaltp 87 q++K++f++YGkv ++v+l++s i++g+fY++ +gv+v+++le+lgl+++ v+ +++s+ g++++AYa+ Ki++p+R+++Tl+ t+ Q5XIJ4 125 QRFKKTFRQYGKVLIPVHLITSGIWFGTFYYASIKGVNVIPFLEFLGLPDSVVDILKNSQSGNALTAYAMFKIATPARYTVTLGGTS 211 79*********************************************************************************9997 PP
Or compare Q5XIJ4 to CDD or PaperBLAST