VIMSS10089703 has 201 amino acids
Query: FAM210A-B_dom [M=88]
Accession: PF06916.17
Description: FAM210A/B-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-31 95.4 0.3 2.1e-31 94.6 0.1 1.5 2 VIMSS10089703
Domain annotation for each sequence (and alignments):
>> VIMSS10089703
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.4 0.0 0.76 0.76 5 11 .. 66 72 .. 64 75 .. 0.80
2 ! 94.6 0.1 2.1e-31 2.1e-31 2 88 .] 102 184 .. 101 184 .. 0.97
Alignments for each domain:
== domain 1 score: -3.4 bits; conditional E-value: 0.76
FAM210A-B_dom 5 elfkkYG 11
e++kkYG
VIMSS10089703 66 EVTKKYG 72
6899999 PP
== domain 2 score: 94.6 bits; conditional E-value: 2.1e-31
FAM210A-B_dom 2 klKelfkkYGkvalgvylsislislgifYllvksgvdvealleklglsekkvekksksswgelaiAYaihKilapiRlpiTlaltpl 88
++Kel++kYG ++l++ +++slis++++Y+lv sgvdv+all k+g+s++++ + ++g++a+AYa+hK+++piR+p T+altp+
VIMSS10089703 102 EAKELLAKYGGAYLATSITLSLISFSLCYVLVTSGVDVQALLLKVGISTNETGE----KVGAFALAYAAHKAASPIRFPPTVALTPI 184
68***************************************************9....88*************************95 PP
Or compare VIMSS10089703 to CDD or PaperBLAST