PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006500122.1 to PF06916 (FAM210A-B_dom)

XP_006500122.1 has 190 amino acids

Query:       FAM210A-B_dom  [M=88]
Accession:   PF06916.17
Description: FAM210A/B-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-34  105.0   1.8    1.6e-34  104.6   1.8    1.1  1  XP_006500122.1  


Domain annotation for each sequence (and alignments):
>> XP_006500122.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.6   1.8   1.6e-34   1.6e-34       1      88 []      85     172 ..      85     172 .. 0.99

  Alignments for each domain:
  == domain 1  score: 104.6 bits;  conditional E-value: 1.6e-34
   FAM210A-B_dom   1 qklKelfkkYGkvalgvylsislislgifYllvksgvdvealleklglsekkvekksksswgelaiAYaihKilapiRlpiTlaltpl 88 
                     q+lK++f++YG+v+++++++isl+slgifY++v+sg+d++a+l klg++e+ v++k+++ ++++++AYaihK++ap+R++iTl+++p+
  XP_006500122.1  85 QQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVVSSGIDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPF 172
                     79************************************************************************************96 PP



Or compare XP_006500122.1 to CDD or PaperBLAST