P64474 has 79 amino acids
Query: DUF1289 [M=48] Accession: PF06945.17 Description: Protein of unknown function (DUF1289) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-23 68.2 5.2 2.9e-23 67.8 5.2 1.1 1 P64474 Domain annotation for each sequence (and alignments): >> P64474 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.8 5.2 2.9e-23 2.9e-23 1 47 [. 12 57 .. 12 58 .. 0.98 Alignments for each domain: == domain 1 score: 67.8 bits; conditional E-value: 2.9e-23 DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47 sPC g+C+ d e+g+CrGC+R++dE+++W++msd e+++vl+ +++r P64474 12 SPCRGICQSD-ERGFCRGCFRSRDERFNWNKMSDGEKQEVLRLCRQR 57 9*********.***********************************9 PP
Or compare P64474 to CDD or PaperBLAST