VIMSS145747 has 121 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.6e-23 66.2 4.7 1.4e-22 65.6 4.7 1.2 1 VIMSS145747
Domain annotation for each sequence (and alignments):
>> VIMSS145747
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.6 4.7 1.4e-22 1.4e-22 1 47 [. 54 99 .. 54 100 .. 0.98
Alignments for each domain:
== domain 1 score: 65.6 bits; conditional E-value: 1.4e-22
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
sPC g+C++d ++g+CrGC+R++dE+++W +m+d ++r+vl+ +++r
VIMSS145747 54 SPCRGICQTD-DRGFCRGCFRSRDERFNWIKMDDGQKREVLRLCHQR 99
9*********.***********************************9 PP
Or compare VIMSS145747 to CDD or PaperBLAST