PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS55776 to PF06945 (DUF1289)

VIMSS55776 has 77 amino acids

Query:       DUF1289  [M=48]
Accession:   PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-21   62.3   8.1    1.5e-21   62.3   8.1    1.5  2  VIMSS55776  


Domain annotation for each sequence (and alignments):
>> VIMSS55776  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.9   0.0      0.37      0.37       7      13 ..       3       9 ..       2      11 .. 0.63
   2 !   62.3   8.1   1.5e-21   1.5e-21       1      47 [.      24      69 ..      24      70 .. 0.97

  Alignments for each domain:
  == domain 1  score: -2.9 bits;  conditional E-value: 0.37
     DUF1289  7 Ckldaed 13
                C++++++
  VIMSS55776  3 CTMSENQ 9 
                7777554 PP

  == domain 2  score: 62.3 bits;  conditional E-value: 1.5e-21
     DUF1289  1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
                sPC+++C+ld ++++C+GCgRt+dEi++Ws++++ e++++l ++ +r
  VIMSS55776 24 SPCVRHCCLD-DKDICIGCGRTIDEICRWSSATNSEKQEILINCLAR 69
                9*********.******************************999887 PP



Or compare VIMSS55776 to CDD or PaperBLAST