VIMSS58239 has 155 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-20 59.0 0.2 3e-20 58.2 0.2 1.5 1 VIMSS58239
Domain annotation for each sequence (and alignments):
>> VIMSS58239
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.2 0.2 3e-20 3e-20 1 46 [. 8 53 .. 8 55 .. 0.97
Alignments for each domain:
== domain 1 score: 58.2 bits; conditional E-value: 3e-20
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlae 46
+PC+g+C++ +d vCrGC+R +E+++W+ ++ ee+rav+ rl++
VIMSS58239 8 TPCVGLCSTVYGDLVCRGCKRFHHEVVNWNLYDAEEKRAVWSRLEQ 53
7*******************************************97 PP
Or compare VIMSS58239 to CDD or PaperBLAST