PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10081352 to PF06972 (GIP1_N)

VIMSS10081352 has 831 amino acids

Query:       GIP1_N  [M=60]
Accession:   PF06972.15
Description: GBF-interacting protein 1 N-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    7.5e-35  105.3   0.3    1.3e-34  104.5   0.3    1.4  1  VIMSS10081352  


Domain annotation for each sequence (and alignments):
>> VIMSS10081352  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.5   0.3   1.3e-34   1.3e-34       1      60 []      17      75 ..      17      75 .. 0.99

  Alignments for each domain:
  == domain 1  score: 104.5 bits;  conditional E-value: 1.3e-34
         GIP1_N  1 ipasvrkviqsikEivgkhsdeeiyamLkecnmDpneavqkLLsqDtFheVkskrdkkKE 60
                   ip+ +rk++qs+ Eiv+   ++eiyamLkecnmDpne+v++LLsqD+FheVksk++kkKE
  VIMSS10081352 17 IPSGSRKIVQSLTEIVN-SPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE 75
                   899*************9.*****************************************9 PP



Or compare VIMSS10081352 to CDD or PaperBLAST